PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012571563.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 238aa    MW: 27421.8 Da    PI: 9.74
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012571563.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.53.6e-281161151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+i++k+ rqvtfskRr+g++KKAeELSvLCdaev +i+fsstgkl++y+s
  XP_012571563.1 11 KKIDDKTARQVTFSKRRKGLFKKAEELSVLCDAEVGLIVFSSTGKLFDYCS 61
                    68***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.7E-38362IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.38363IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-26525IPR002100Transcription factor, MADS-box
PROSITE patternPS003500559IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.89E-31574IPR002100Transcription factor, MADS-box
PfamPF003193.6E-261259IPR002100Transcription factor, MADS-box
CDDcd002657.05E-311871No hitNo description
PRINTSPR004042.5E-262540IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-264061IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.93188182IPR002487Transcription factor, K-box
PfamPF014864.4E-1393172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MKMKRKKITI KKIDDKTARQ VTFSKRRKGL FKKAEELSVL CDAEVGLIVF SSTGKLFDYC  60
STSMKDTITR YNAQDHGINK LNTPSQELQL EASNRIKLDK EIADRTQQLK QMKGDDIEAL  120
NLNELQLLEK TLHIGFNRVI ETKEKRIMSE ISDLQKMETV LKEENKLLKH KVRNKVEVRQ  180
MISMMSKTRC PSLIDSKIGI QEERVSLDSI SCASDPLFED DYSDTSLKLG LPFSNRRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A1e-19573270Myocyte-specific enhancer factor 2A
3mu6_B1e-19573270Myocyte-specific enhancer factor 2A
3mu6_C1e-19573270Myocyte-specific enhancer factor 2A
3mu6_D1e-19573270Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012571562.11e-173PREDICTED: MADS-box protein SVP-like isoform X1
RefseqXP_012571563.11e-174PREDICTED: MADS-box protein SVP-like isoform X2
SwissprotQ9FVC12e-71SVP_ARATH; MADS-box protein SVP
TrEMBLA0A0B2PN633e-96A0A0B2PN63_GLYSO; MADS-box protein SVP
TrEMBLC6T8M23e-96C6T8M2_SOYBN; Uncharacterized protein
STRINGGLYMA06G10020.21e-95(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-59MIKC_MADS family protein